PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G40950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 299aa    MW: 33024.2 Da    PI: 7.3015
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G40950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.6e-083177347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +W++eE + + +a +q   +   +W+ +a++++ ++t  +++++++++
  ORUFI01G40950.1 31 AWSAEENKVFERALAQVDLDspnRWEMVAAMLP-RKTVIDVVNHYRDL 77
                     7****************99999***********.***********986 PP

2Myb_DNA-binding44.34e-14138182347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++ ++ + k++G g+W+ I+r++ + Rt+ q+ s+ qky
  ORUFI01G40950.1 138 PWTEEEHKSFLMGLKKYGRGDWRNISRYFVTSRTPTQVASHAQKY 182
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-42177IPR009057Homeodomain-like
PROSITE profilePS512936.5962781IPR017884SANT domain
SMARTSM007173.5E-72880IPR001005SANT/Myb domain
SuperFamilySSF466892.07E-103185IPR009057Homeodomain-like
CDDcd001676.80E-73177No hitNo description
PROSITE profilePS5129416.496131187IPR017930Myb domain
SuperFamilySSF466899.66E-18133187IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-17134185IPR006447Myb domain, plants
SMARTSM007177.6E-12135185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11135181IPR009057Homeodomain-like
PfamPF002491.6E-11138182IPR001005SANT/Myb domain
CDDcd001671.42E-10138183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MMAEALREVL PLPYFPGQPC WYLQERRGAE AWSAEENKVF ERALAQVDLD SPNRWEMVAA  60
MLPRKTVIDV VNHYRDLEND VGSIEAGLVP FPHYSSSLSP ASSGFTLQDW DGSDGGFRRG  120
CYLKRGRAPD QERKKGVPWT EEEHKSFLMG LKKYGRGDWR NISRYFVTSR TPTQVASHAQ  180
KYFIRLNSGG KDKRRSSIHD ITTVNLPEED TSNPSPSPPS VLTTASDQLG SLVDTKPVPP  240
PPSLGAQRHF MSPLPGALGV SHHPYGNVKL EPNASFLAGG GTGPGLDDAI LLQMQCGHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-142697576RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402140.0FJ940214.1 Oryza sativa Japonica Group clone KCS611H03 Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621447.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H75e-78DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA2WX320.0A2WX32_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0FVW70.0A0A0E0FVW7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0CAF70.0A0A0E0CAF7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N5440.0A0A0E0N544_ORYRU; Uncharacterized protein
TrEMBLI1NTF40.0I1NTF4_ORYGL; Uncharacterized protein
TrEMBLA0A0D9YHF30.0A0A0D9YHF3_9ORYZ; Uncharacterized protein
TrEMBLA0A0D3EWD30.0A0A0D3EWD3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000472-PA0.0(Oryza sativa Indica Group)
STRINGORGLA01G0314400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-79MYB family protein